Scaffold 2006903419

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2006903419

Scaffold 2006903419

Overview

Basic Information
Taxon OID	2006543006 Open in IMG/M
Scaffold ID	2006903419 Open in IMG/M
Source Dataset Name	Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	812
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Anoxic Basin Of Saanich Inlet In Vancouver, Canada

Source Dataset Sampling Location
Location Name	Saanich Inlet, British Columbia, Canada
Coordinates	Lat. (^o)	48.616667	Long. (^o)	-123.5	Alt. (m)		Depth (m)	100
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006870	Metagenome / Metatranscriptome	363	Y

Sequences

Protein ID	Family	RBS	Sequence
2007051875	F006870	N/A	MKKMSQILLLILSLVLTNKVGSFETKLSPQGSDKYNFLIIGGDKSNEKKLRDIFQNKVNEICGTRFEIISIKMNHLSKEGAKKNILNGTFKCFVNSQM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.