Basic Information | |
---|---|
Taxon OID | 2007427000 Open in IMG/M |
Scaffold ID | 2007442236 Open in IMG/M |
Source Dataset Name | Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 887 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides humi | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | DOE Field Research Center Area 3 Well FW106, Oakridge, TN | |||||||
Coordinates | Lat. (o) | 36.11569 | Long. (o) | -84.248657 | Alt. (m) | Depth (m) | 21 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089295 | Metagenome / Metatranscriptome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2007447690 | F089295 | N/A | VPATRHESWAYLLPRAVIVLIAWGTTCLIMNTFTSVDPLLFYIAGGVWSFVGLISFGYLHRLRREEDAQFARAIARAITPAE |
⦗Top⦘ |