Basic Information | |
---|---|
Taxon OID | 2008193000 Open in IMG/M |
Scaffold ID | 2008202481 Open in IMG/M |
Source Dataset Name | Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 759 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Palmer Station B, Arthur Harbor, Antarctic Peninsula | |||||||
Coordinates | Lat. (o) | -64.766667 | Long. (o) | -64.05 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035964 | Metagenome / Metatranscriptome | 171 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2008204329 | F035964 | N/A | KFREIFGIRLGAKPSIELRTAVKVLEKNKERSNMSFNYILSEYKKEMIRNDKKTDGKNFEGRLRRILYRSIESGITRESIQGIKFNLNANYKGIKVITSQPFVFNNSANVARKDVEENLYTFKFNKVVTLINKAELKTVADKVKAFKTLIR |
⦗Top⦘ |