NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2008208842

Scaffold 2008208842


Overview

Basic Information
Taxon OID2008193001 Open in IMG/M
Scaffold ID2008208842 Open in IMG/M
Source Dataset NameMarine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1378
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location
Location NameArthur Harbor, Palmer Station, Antarctic Peninsula
CoordinatesLat. (o)-64.766667Long. (o)-64.05Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090895Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
2008211313F090895N/AMNKRDQGRADKRDAKLLQKEEDLKTIRSVVSNKNTSALDITKDSGKATSLVSYKRTTEVVKLILRGVRYTDIMEYCEAHWGIKKRMASIYYKKALETFAEQFSEEREYEMDKHAIMLQDLYSQGYKAGDLNICRLLLQDIAKM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.