NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2008210536

Scaffold 2008210536


Overview

Basic Information
Taxon OID2008193001 Open in IMG/M
Scaffold ID2008210536 Open in IMG/M
Source Dataset NameMarine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)809
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location
Location NameArthur Harbor, Palmer Station, Antarctic Peninsula
CoordinatesLat. (o)-64.766667Long. (o)-64.05Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016456Metagenome / Metatranscriptome247N

Sequences

Protein IDFamilyRBSSequence
2008213581F016456N/AMPRKPNYKDLLKKFKKRNIKNPERIATAYVKGLTAGSKKKAAKNLAGIIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.