Scaffold 2008218863

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2008218863

Scaffold 2008218863

Overview

Basic Information
Taxon OID	2008193001 Open in IMG/M
Scaffold ID	2008218863 Open in IMG/M
Source Dataset Name	Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	752
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location
Location Name	Arthur Harbor, Palmer Station, Antarctic Peninsula
Coordinates	Lat. (^o)	-64.766667	Long. (^o)	-64.05	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058644	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
2008223942	F058644	N/A	LAPNLHEIKLEAKNVEKTNPIRGKKTAYIIKIIAVIKISKIFPNLGHLGFISGLKIRNKDDVIKKKETIYGYVFGPMWSEIKLSSTMYAEKM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.