Scaffold bisonPool05dec07_C574

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold bisonPool05dec07_C574

Scaffold bisonPool05dec07_C574

Overview

Basic Information
Taxon OID	2009439003 Open in IMG/M
Scaffold ID	bisonPool05dec07_C574 Open in IMG/M
Source Dataset Name	1_050719N
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	4389
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location
Location Name	Bison Pool, Yellowstone National Park
Coordinates	Lat. (^o)	44.6	Long. (^o)	-110.9	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043237	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
BISONN_1943	F043237	GGAGG	MELERTARYIAQLSSRGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLSAKPLEFPNAPLKLHYDEKTGRLRLLAQRSFINECLRVIERASSLKYPNHKLYTIKVNEALRNLYSILAYTYNDRERLRAIKRKVKHLFVSALKENYGIEPKKAMEEYRRFVVKFSDVLRKKQRANSSTS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.