NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BISONR_C1656

Scaffold BISONR_C1656


Overview

Basic Information
Taxon OID2010170001 Open in IMG/M
Scaffold IDBISONR_C1656 Open in IMG/M
Source Dataset Name3_050719R
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3565
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location
Location NameBison Pool / Rosette Geyser, Yellowstone National Park
CoordinatesLat. (o)44.6Long. (o)-110.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067777Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
BISONR_45860F067777N/AMPKLTIEVDPKAWQLLHQQAELRGLTPEALAQQLLLGELRARGKRSRRRDMDNESLHAASLPRGSLQRVFTTLERIDTLLPLDTPPPSREEVDAYLEQERASWENPDGV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.