NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BISONQ_BXBH17430_g1

Scaffold BISONQ_BXBH17430_g1


Overview

Basic Information
Taxon OID2010170002 Open in IMG/M
Scaffold IDBISONQ_BXBH17430_g1 Open in IMG/M
Source Dataset Name4_050719Q
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)860
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location
Location NameBison Pool / Rosette Geyser, Yellowstone National Park
CoordinatesLat. (o)44.6Long. (o)-110.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070749Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
BISONQ_540250F070749N/AVNPTILARLVLILLLLSIACEGGKKSTFQLPPDIGKGLSPADSLRAVLNYLEGRREYQAETLRFHYMYEYIRTLARQKPDTLPALVQALRRWAQKSKYLLGEGMAALGEAQRWWSQGQYDSALSRAQTL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.