Basic Information | |
---|---|
Taxon OID | 2010170003 Open in IMG/M |
Scaffold ID | BISONP_C14708 Open in IMG/M |
Source Dataset Name | 5_050719P |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3161 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bison Pool / Rosette Geyser, Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.6 | Long. (o) | -110.9 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028182 | Metagenome / Metatranscriptome | 192 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BISONP_332340 | F028182 | GGCGG | MRYNTLVMPKVSISEAARRLDTTEEVIREWIRLGLLDVEPLPLERQRAKENILALHVSGIDLDSCVRGIDSEPRVDLEQLYEVAEREGWLLLSLEAWDAADSEP |
⦗Top⦘ |