NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BISONP_C4397

Scaffold BISONP_C4397


Overview

Basic Information
Taxon OID2010170003 Open in IMG/M
Scaffold IDBISONP_C4397 Open in IMG/M
Source Dataset Name5_050719P
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1421
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location
Location NameBison Pool / Rosette Geyser, Yellowstone National Park
CoordinatesLat. (o)44.6Long. (o)-110.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002970Metagenome / Metatranscriptome517N
F004791Metagenome / Metatranscriptome423Y
F005302Metagenome / Metatranscriptome405Y

Sequences

Protein IDFamilyRBSSequence
BISONP_100290F004791GGAGGMTKPAEIYDIETISVDRSALTIREAATVLNNELTAPVVARLVRKAIGSQVDRFPLRALKRVYERVLPQIFEPDEAVRSRAAGLTPDVSQITLGEYHEFLDASERKIAFPEVAKTLLIKAYGEGILDEPYAAAALLLKKSLTRSETRE
BISONP_100300F005302AGGAGGMSHSGVIDGLFAGNFAVEISTNNTAWTAVSNATVKIDDVELSRPTGEAYVGGSSDYATVTIGKREPVELTLTFLYNEASGSAATTIFDRFQSATPTLGVRWSPRGLVSGARAYGTSNDGGATFGLGVITSVTLSALDPSDAEPYVAMVTVRTPSLRQYTLGANPTNLNPAS
BISONP_100310F002970N/AIIELLAGLAVQYNNVVVPVQRLASQPNWSDAAQLPVRIIPVLSGLRLVEGGVYTPTRATRAVWEIDDLLLVRDVGMGRGVADTAAALVDYIEDYVAQLRFAWLTRGDVQLLNVSGIVDVVRYGERAYEGVAMTTRFAHLIRAPSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.