Basic Information | |
---|---|
Taxon OID | 2010484004 Open in IMG/M |
Scaffold ID | UBABS_BWON22702_y1 Open in IMG/M |
Source Dataset Name | Acid Mine Drainage (ARMAN) microbial communities from Richmond mine, Iron Mountain, CA, sample from Ultra Back A BS |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI), University of California, Berkeley |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 823 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage (Amd) → Acid Mine Drainage (Amd) Microbial And Viral Communities From Richmond Mine, Iron Mountain, Ca |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Iron Mountain California | |||||||
Coordinates | Lat. (o) | 40.678099 | Long. (o) | -122.515068 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026917 | Metagenome | 196 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
UBABS_240240 | F026917 | GGAG | MIHAADMCDAERQIRQKVIMVVADETRFGTLSTGERIAVALVLERYDLLQRAWGRMLESVHRLGPLWTEAALRVQRQGWEEDPTS |
⦗Top⦘ |