Scaffold 2014615646

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2014615646

Scaffold 2014615646

Overview

Basic Information
Taxon OID	2014613002 Open in IMG/M
Scaffold ID	2014615646 Open in IMG/M
Source Dataset Name	Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 1_Upper_euphotic_10m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	983
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location
Location Name	North Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station
Coordinates	Lat. (^o)	22.45	Long. (^o)	-158.0	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007891	Metagenome / Metatranscriptome	343	Y

Sequences

Protein ID	Family	RBS	Sequence
2014621281	F007891	N/A	MTLYSNFFSSAINSVEINEKVVKITYSSNLDKVYEYKCENIPEFSNSLCSVLTSNELLQDGGSVGKFIHKSRREKVLVDI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.