NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2014616526

Scaffold 2014616526


Overview

Basic Information
Taxon OID2014613002 Open in IMG/M
Scaffold ID2014616526 Open in IMG/M
Source Dataset NameMarine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 1_Upper_euphotic_10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1031
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location
Location NameNorth Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station
CoordinatesLat. (o)22.45Long. (o)-158.0Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025142Metagenome203Y
F097509Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
2014622547F025142N/ASGPGDHTLQLQITDSTGTAKNLSNDVTYATGKWKVWKPDGTSLINGSITFDTRSTGDISYTLSATDATNAKAGRWEGEVELLDSNGDISEQTESFTFIIDESY
2014622548F097509N/AMLKLEDINNEVYFKFRKAQVEAMETERLGKIHVSDVIKPCDRYTIYGKISPKTMSTEDMKSLYIGQAVHNNSKLATDENHEKFLAWDWVEDKPLTYEEAKKIPEGDPKHLDIIYGSIDDLLKVGDKWIITDKKTTGSIGYFSKASSKPSDSHKDQINRYRVLLHKCYGINADFGCVIYISNSISKRVRDKPACLSFKLHLYEEIVEGYEPKSRIIKDALLDKTFPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.