NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2014698868

Scaffold 2014698868


Overview

Basic Information
Taxon OID2014642005 Open in IMG/M
Scaffold ID2014698868 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from Ionian Km3 Station
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)819
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Deep Mediterranean Sea

Source Dataset Sampling Location
Location NameMediterranean Sea, Ionian Km3 Station
CoordinatesLat. (o)36.4999Long. (o)15.693611Alt. (m)Depth (m)3010
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041257Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
2014725015F041257N/AMQEFKPNYRPLGSEEDDVVDPRSEQPDGPFDHERFKTLTVLAHAAGQVMDRYAIKGFEGFTNRQANWACKLQSFFNLSNPFETLVLLLFTFQFSRNERFDLEMGKTEPIDRSHPLSKALMAWVWWDPSSEASCVDRFYPWEYGKERTSRMVAIASGLLPEPIDVTSSGDIPPSPPRTQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.