NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MAnammo_C2172

Scaffold MAnammo_C2172


Overview

Basic Information
Taxon OID2017108002 Open in IMG/M
Scaffold IDMAnammo_C2172 Open in IMG/M
Source Dataset NameBioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)8539
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands

Source Dataset Sampling Location
Location NameNijmegen, The Netherlands
CoordinatesLat. (o)51.842Long. (o)5.858Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061392Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
MAnammox_158480F061392N/AMPLQTFASGLDEPDPAFKLAAALSPIDGGELYVGNVDRDKKTFRLHLRHIGKNSKWVYYYASASAFVNEDGDVEPDNAVASLVYPQYTASVIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.