Scaffold LTJ07As871_J07ABscf088459

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LTJ07As871_J07ABscf088459

Scaffold LTJ07As871_J07ABscf088459

Overview

Basic Information
Taxon OID	2025206003 Open in IMG/M
Scaffold ID	LTJ07As871_J07ABscf088459 Open in IMG/M
Source Dataset Name	Hypersaline water microbial communities from Lake Tyrrell, Victoria, Australia, sample J07AB- all scaffolds
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1346
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halonotius → Halonotius terrestris	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Hypersaline Water Metagenomes Of Microbial Communities From Lake Tyrrell, Victoria, Australia

Source Dataset Sampling Location
Location Name	Lake Tyrrell, Victoria, Australia
Coordinates	Lat. (^o)	-35.309	Long. (^o)	142.7795	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054456	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
LTJ07AB_58390	F054456	GGAG	VTNLQADDLERLEDSRRNELYLEQAEGNQTQDNPPLPGGPLADAQTLAATPRDEWTKDHRAEAEEAINFLSRTMPQFEQSEGEPLIEDKSPKVHKDELSIMRWGVDPKPEDDFL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.