NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Nasutiter_FTJKGMZ01BG8QZ

Scaffold Nasutiter_FTJKGMZ01BG8QZ


Overview

Basic Information
Taxon OID2030936001 Open in IMG/M
Scaffold IDNasutiter_FTJKGMZ01BG8QZ Open in IMG/M
Source Dataset NameNasutitermes corniger hindgut microbial communities from Florida, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)504
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Termopsidae → Termopsinae → Termopsini → Zootermopsis → Zootermopsis nevadensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut → Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa

Source Dataset Sampling Location
Location NameFlorida, USA
CoordinatesLat. (o)26.135Long. (o)-80.129Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063804Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Nasutiterm_2028140F063804N/APLGGPLARSHVRRLQVLQSKCLRLATGAPLVRNRQIHEDLGVPLFADHIRALTASFDSKLADVKNPLARQLGRYLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.