Basic Information | |
---|---|
Taxon OID | 2035265000 Open in IMG/M |
Scaffold ID | ErSWdraf_F5BXKTZ02F19TL Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Royal Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 506 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Swedish Lakes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erken, Sweden | |||||||
Coordinates | Lat. (o) | 59.84 | Long. (o) | 18.63 | Alt. (m) | Depth (m) | 0 to 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021965 | Metagenome / Metatranscriptome | 216 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ErSWdraft_8771100 | F021965 | AGAAG | MGIPMKFLPSNYDNLQDEDREKAEKIGEKEINRILDEMIFAFDYIIDPDKYVTFPKSCSWDIKDKNYFNREKNLEAKQSWDEYTKTCEQLDTRKKQGLQLFVEHMDMLWI |
⦗Top⦘ |