Basic Information | |
---|---|
Taxon OID | 2040502000 Open in IMG/M |
Scaffold ID | ACOD_F64RS5002G9JTZ Open in IMG/M |
Source Dataset Name | Fungus garden microbial communities from Atta colombica in Panama - dump bottom |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences, DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 530 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden → Fungus Garden Microbial Communities From Leaf-Cutting Ants In Gamboa, Panama |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gamboa, Panama | |||||||
Coordinates | Lat. (o) | 9.1167 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | .5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030702 | Metagenome / Metatranscriptome | 184 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ACODB_20655110 | F030702 | GGAGG | MSALETKLGRRQVLKGMLIAGPTLAVAGRISFADSAGAFPTKTDELPDAQDFTDIFILSQQPTIY |
⦗Top⦘ |