Scaffold MGB_F548DK201CMR2F

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MGB_F548DK201CMR2F

Scaffold MGB_F548DK201CMR2F

Overview

Basic Information
Taxon OID	2044078003 Open in IMG/M
Scaffold ID	MGB_F548DK201CMR2F Open in IMG/M
Source Dataset Name	Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	513
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location Name	UIUC Energy Farm, Urbana, Illinois 61801
Coordinates	Lat. (^o)	40.109	Long. (^o)	-88.204	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046884	Metagenome / Metatranscriptome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
MGB_654160	F046884	N/A	MRRYRKQRKQGLRPVRILLGETDIDALICMKLLKEDQRQDPKALQRAVLGLLYRAEEDLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.