Basic Information | |
---|---|
Taxon OID | 2044078014 Open in IMG/M |
Scaffold ID | ANME2c_2_ANME2c_2025433 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from the Eel River Basin, Pacific Ocean, containing methane-oxidizing consortia - ANME2c_2rp |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences, Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 511 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Eel River Basin, Pacific Ocean, Containing Methane-Oxidizing Consortia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eel River Basin, California, USA | |||||||
Coordinates | Lat. (o) | 40.74703 | Long. (o) | -123.869505 | Alt. (m) | Depth (m) | 500 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054877 | Metagenome / Metatranscriptome | 139 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ANME2c_2_722560 | F054877 | AGGAG | MKPIKNLRVLARFSPKTTDDLEPELSNLVGTEAVFSYHRYVDADDTPYSEQWVLTAEDQRFGDYWFPECDLEVLQEMHSA |
⦗Top⦘ |