NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 900MB_Assembly_NODE_871879_len_16183_cov_1_247544

Scaffold 900MB_Assembly_NODE_871879_len_16183_cov_1_247544


Overview

Basic Information
Taxon OID2049941000 Open in IMG/M
Scaffold ID900MB_Assembly_NODE_871879_len_16183_cov_1_247544 Open in IMG/M
Source Dataset NameBovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - 900 MB Assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16233
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036964Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
_900MB_Assembly_4447070F036964AGGAGGMNVLKMLFPGLMVLGALGSLIVNIIERGDGAVSLQWIGACLLYTALLLRNMS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.