NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold mhc6b_MHC6B_contig33558

Scaffold mhc6b_MHC6B_contig33558


Overview

Basic Information
Taxon OID2051223007 Open in IMG/M
Scaffold IDmhc6b_MHC6B_contig33558 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Orebro University Hospital, Sweden - Sample 10375
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1541
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Source Dataset Sampling Location
Location NameOrebro University Hospital, Sweden
CoordinatesLat. (o)59.274717Long. (o)15.230656Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064817Metagenome128N

Sequences

Protein IDFamilyRBSSequence
MHC6B_contig33558_metagene_gene_1F064817N/AMNIKNLFNRFRKREPELSYSLNLIYLEDTKVVFNQNIQCAKDLENYLSAYMRLFGMYSDKPYVLIYQEYKSRYWVYDKEPYLLYYKVPLIVNLSRKLSGKSDMVITKEKYQAVKDLVPAHEVSDRFKIPEYITGVFTDIWYKCQGYMDTDHVGLEEILELMQYNWLKEFELLVFKRNYDTDMLFLNHSLTYILDQTEEEGRRICIQNIIERNINQENQDENETI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.