Basic Information | |
---|---|
Taxon OID | 2051774008 Open in IMG/M |
Scaffold ID | GSLNARP_contig00043 Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Great Salt Lake, Utah, sample from North Arm Rozel Point |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 610 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Great Salt Lake | |||||||
Coordinates | Lat. (o) | 41.454358 | Long. (o) | -112.666397 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088354 | Metagenome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GSLNARP_01377800 | F088354 | GGAG | MTDTDTPRAQLDVDRFETATVNANGQIYLGRDLQGVKVHVAIEIVTDDD |
⦗Top⦘ |