NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rumenHiSeq_NODE_4172213_len_117456_cov_1_266704

Scaffold rumenHiSeq_NODE_4172213_len_117456_cov_1_266704


Overview

Basic Information
Taxon OID2061766007 Open in IMG/M
Scaffold IDrumenHiSeq_NODE_4172213_len_117456_cov_1_266704 Open in IMG/M
Source Dataset NameBovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)117506
Total Scaffold Genes199 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)174 (87.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046769Metagenome / Metatranscriptome150Y
F102285Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
_HiSeq_13603470F102285AGGAGGMKIIANKDFTTKYEQYVKGDEIKNLTYEQIVKLNELGFIEPLSYKDLVLVKRELETSNKKKEEL
_HiSeq_13603500F046769GGAGMITNSSLTVYHKEDYLDIATHLEVWTRHNYDKVWFFGGKGAGINKGYDNANDVQVRIPYDQNSGLDINDFAIGDILVQGTLDIDIETQEDLDNYLIYNITSINNNNFGNNQHIHLGGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.