NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rumenHiSeq_NODE_4307003_len_78378_cov_1_117724

Scaffold rumenHiSeq_NODE_4307003_len_78378_cov_1_117724


Overview

Basic Information
Taxon OID2061766007 Open in IMG/M
Scaffold IDrumenHiSeq_NODE_4307003_len_78378_cov_1_117724 Open in IMG/M
Source Dataset NameBovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)78428
Total Scaffold Genes167 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)111 (66.47%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065312Metagenome / Metatranscriptome127Y
F086398Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
_HiSeq_09714170F065312AGGAGGMSKKKNRKPKTWVEVFQSERREFPQGYCVTRIREDKRRKKPKYRKVDDE
_HiSeq_09714190F086398AGGAGMNEQMSYHVRVDRAERVQHIVNEIGMGQIIKEKYIGYGIGGQPGRYLCITDTGVTIIKTEDKQKIITMYVTTQRELVMVYGGQKKIPPFLKRKVDHNQSLFTKDGKTVWTN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.