Scaffold rumenHiSeq_NODE_4378828_len_3213_cov_1_295985

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold rumenHiSeq_NODE_4378828_len_3213_cov_1_295985

Scaffold rumenHiSeq_NODE_4378828_len_3213_cov_1_295985

Overview

Basic Information
Taxon OID	2061766007 Open in IMG/M
Scaffold ID	rumenHiSeq_NODE_4378828_len_3213_cov_1_295985 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities fromthe University of Illinois at Urbana-Champaign, USA, that are switchgrass associated - Sample 470
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3263
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location Name	University of Illinois at Urbana - Champaign, Illinois, USA
Coordinates	Lat. (^o)	40.096	Long. (^o)	-88.2315	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098416	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
_HiSeq_04966640	F098416	N/A	LLVILISSTLXXXYLSGALAEALKDVKLNDEKIQAKFNKVVGYLNFINSFIGAKLKLEYDAKVLAGEGAKEAEKKAGGAEDLKTKISGAQAMAMGMGSSMVAPMISSFGMTDTVKALDLDSFSISIGVPQYENGYAISIKIPGLSQVLGGMLDAPAQPPK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.