Scaffold ADL24m1u_GMS257A01DSTHL

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ADL24m1u_GMS257A01DSTHL

Scaffold ADL24m1u_GMS257A01DSTHL

Overview

Basic Information
Taxon OID	2084038011 Open in IMG/M
Scaffold ID	ADL24m1u_GMS257A01DSTHL Open in IMG/M
Source Dataset Name	Hypersaline microbial communities from Antarctic Deep Lake - 24m 0.1um
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	544
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location
Location Name	Deep Lake Antarctica
Coordinates	Lat. (^o)	-68.54	Long. (^o)	78.18	Alt. (m)		Depth (m)	24
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100063	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
ADL24m1u_00745900	F100063	GAG	MSETCEVCGQFTGQTASFDLWIRGLDRRGEGDRIEIDVSGVSVGECCGLGVLQGPDETRVDRSYQRYLNGTSDGELRYVVMIRDEI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.