NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LWFCAnN_contig00987

Scaffold LWFCAnN_contig00987


Overview

Basic Information
Taxon OID2088090007 Open in IMG/M
Scaffold IDLWFCAnN_contig00987 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted anaerobic plus nitrate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)815
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location NameLake Washington, Seattle, Washington, USA
CoordinatesLat. (o)47.63Long. (o)-122.27889Alt. (m)Depth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007859Metagenome / Metatranscriptome343Y
F008688Metagenome / Metatranscriptome329N
F010081Metagenome / Metatranscriptome308Y
F013524Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
LWFCAnN_08746270F010081N/AMKEQIDAIIKKHCLKMQEVDKNKSIPMTVKDLDHIVYDMYRELYGLRDIRASNYNLN
LWFCAnN_08746280F007859GAGMKNLLIIALLCTGCTSGMYLRYSYNRALENLPPCSRIHAINNDYITYSMIKNSTNSVYTVYTNYYRAYYNCDGKITKIIKN
LWFCAnN_08746290F008688N/AMNRFNKIIVGGLAAILLTAMTVEPPKIKVYLITSYRGNDLTIEKVYLKKENAEKYRDMYKDSHNYSVEERELTE
LWFCAnN_08746300F013524N/ALRQFTSYNCNNLLDAKLCEDIRYLCDEVERFSKEIVKANNHMDEDHITIQRYKKKLSKYESI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.