Basic Information | |
---|---|
Taxon OID | 2088090012 Open in IMG/M |
Scaffold ID | ASHM260b_contig00572 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-236-260cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 572 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean | |||||||
Coordinates | Lat. (o) | 74.0678 | Long. (o) | -145.54687 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050383 | Metagenome / Metatranscriptome | 145 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ASHM260b_03283710 | F050383 | N/A | MENLYEQLEELIDTIKYSHAAGDEDPDYLENDYFEDVVEACKEIVKYTNN |
⦗Top⦘ |