NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LWAnNN_contig18887

Scaffold LWAnNN_contig18887


Overview

Basic Information
Taxon OID2088090013 Open in IMG/M
Scaffold IDLWAnNN_contig18887 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13Cmethane anaerobic no nitrate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6239
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location NameLake Washington, Seattle, Washington, USA
CoordinatesLat. (o)47.07Long. (o)-122.27889Alt. (m)Depth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082695Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
LWAnNN_03285360F082695N/AMYLIYHYLKTHLFVQFTFFSYESETGDETDVAKWAHKLMNRSVANRTITKQEAMCELGGLPMVICSESIETISITGSTKCATDTNTSTILSQYRNRPDAQQHLSLHQFYHIKKNKKLASTPSYREFIPHYVGGKGQPVYPITRSYARSELLKHLPWGRKNPMPNDCDLITMFKQFLENPKCPVGVRLGFERAKLRKELKEKGIQEAFQPDIEHSSNTDDVDDDEVGEVIALTESLGYTEDELEKLENNGFFSWKGLRLGETDIYSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.