NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GPIPI_16920329

Scaffold GPIPI_16920329


Overview

Basic Information
Taxon OID2088090014 Open in IMG/M
Scaffold IDGPIPI_16920329 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4239
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032566Metagenome / Metatranscriptome179Y
F081698Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
GPIPI_02929810F081698N/AMRPIFFSAVLIFIASSNVQSTEALFFSGGGYTIAILIGYLDDPVIAQVRFTPPEAKNSVSIPRELLRVEKFDMKKRVMTMHFSNKNDPDLPASFSLSVKKTKAVLSIGGKEISGEEFNWD
GPIPI_02929830F032566GGALWPPEVVRYGWKLPKRIEAPHPREVLSPVVGIVTPAESLEERLKHDAEATRVGLSTATRKASVSLAERDGDEVVYVSARLKDVVSSAAQLHGWNQPAGVNVNIANIPMPTEEERAEMREIDRKLDAIAAKLRLRSDRC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.