Scaffold ASMM170b_GM97KZC01ALFUP

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ASMM170b_GM97KZC01ALFUP

Scaffold ASMM170b_GM97KZC01ALFUP

Overview

Basic Information
Taxon OID	2100351011 Open in IMG/M
Scaffold ID	ASMM170b_GM97KZC01ALFUP Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	511
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location
Location Name	Arctic Ocean
Coordinates	Lat. (^o)	74.0678	Long. (^o)	-145.54687	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042580	Metagenome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
ASMM170b_08988900	F042580	N/A	MARPKLPEIEKIQNRVRKRYPGSICVQDSFGQYYIQWNEENLNDTFLLDNTDTELSAWSQASITAKHEQHINRTHPLKQMLSEEKKQQNKERINIRIQKL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.