NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold t454_GJGVOYN01CBAVO

Scaffold t454_GJGVOYN01CBAVO


Overview

Basic Information
Taxon OID2124908015 Open in IMG/M
Scaffold IDt454_GJGVOYN01CBAVO Open in IMG/M
Source Dataset NameTongue_dorsum_contig300
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Tongue → Human Tongue Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location
Location NameHouston, TX
CoordinatesLat. (o)29.774Long. (o)-95.361032Alt. (m)Depth (m)95.383
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032313Metagenome180N

Sequences

Protein IDFamilyRBSSequence
t454_05016840F032313N/ADNDTPQEKPREQEKHEVPVPKPKPQFDEVGERIWYGRTPAMRLDSTDYGAGLTSVFGMRTSSIPKQRFDSLFKQTVWEIKDICAVETDLSLAKKIPKFVGGSITKEFTCRNGVILRHMQGIDINLVDTVNYVYNEDLNEIVLEGTGIRWYVLRLNNMQSNFC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.