NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_184117_length_1048_cov_6.956107

Scaffold NODE_184117_length_1048_cov_6.956107


Overview

Basic Information
Taxon OID2140918013 Open in IMG/M
Scaffold IDNODE_184117_length_1048_cov_6.956107 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1080
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)41.827222Long. (o)-93.008611Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043382Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Iowa-Corn-GraphCirc_01120490F043382GAGGMTSEQMNYRAQQAEHLLERFSELEREHESAGFYEEALEARRLRLEQEAAVSYWRGXXXXX

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.