NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_302486_length_1623_cov_16.923597

Scaffold NODE_302486_length_1623_cov_16.923597


Overview

Basic Information
Taxon OID2140918013 Open in IMG/M
Scaffold IDNODE_302486_length_1623_cov_16.923597 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1655
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)41.827222Long. (o)-93.008611Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001115Metagenome / Metatranscriptome774Y
F048650Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Iowa-Corn-GraphCirc_01913880F001115GGCGGVSDQLPNSKQKLKIKRCEGIGDNMKNDLQNLTEDISRLYEDITQKAESLGQIDSITRLYDELQSQLQGISTEEVELLQSQIKSTLEQMVGISKSLAVIKTLKVTLNGRDEFADLSKKSHDGKDGRRSLEDR
Iowa-Corn-GraphCirc_01913900F048650GGAGGMPQETASMEGSKVIRPVNLNWQRGGLRWKISTTFSGLILVLGLLVIGIVYYFTANA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.