NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_315035_length_1603_cov_6.010605

Scaffold NODE_315035_length_1603_cov_6.010605


Overview

Basic Information
Taxon OID2140918013 Open in IMG/M
Scaffold IDNODE_315035_length_1603_cov_6.010605 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1635
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)41.827222Long. (o)-93.008611Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077596Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Iowa-Corn-GraphCirc_03249920F077596GAGLNLEGQRRNFGMATAIAIQAFNKADSVLGTLESIVRARGSKDYDLFVLQDGCXXXXAFNKADSVLGTLKSIVRARGSKDHDLFVLQDGCSGSNQTEKYCAAWAETSQALKSWISENRDNFAAIHFESSEQNDGPYQTAERLITWALETSKSVIFSEDDVIFECDAVEWFERALTHPMFLRSNVWAIAGESRFFDSNRHFPSDADVCRALEVAQTRNLIERFVYLDFLPSSCFATTRDKWAEFGKTRGTTNGDRAVVERCRAEAKLCFWPVVARCRDIGMHHPLGYSVRWKGLHHKGFKNSYIVSGMLKGMSDELSELTFEKDALLTEFTVFWEQLES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.