Scaffold NODE_57621_length_14383_cov_13.506570

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NODE_57621_length_14383_cov_13.506570

Scaffold NODE_57621_length_14383_cov_13.506570

Overview

Basic Information
Taxon OID	2140918024 Open in IMG/M
Scaffold ID	NODE_57621_length_14383_cov_13.506570 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14433
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location Name	Bonanza creek, Alaska, USA
Coordinates	Lat. (^o)	64.7	Long. (^o)	-148.3	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008634	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
B_all_v_02536580	F008634	GGAG	MYGQGRELEIGNATSAVLISLLQTLVDKGVVSNAEVRALLAKAASDLGPHDYTAPVKGAIGVILDDILPKFPENGGD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.