NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold contig09270

Scaffold contig09270


Overview

Basic Information
Taxon OID2140918027 Open in IMG/M
Scaffold IDcontig09270 Open in IMG/M
Source Dataset NameHypersaline microbial communities from Antarctic Deep Lake - 36m 3.0um, 0.8um, 0.1um pool
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)991
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location
Location NameDeep Lake Antarctica
CoordinatesLat. (o)-68.54Long. (o)78.18Alt. (m)Depth (m)36
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028664Metagenome191Y

Sequences

Protein IDFamilyRBSSequence
ADL36m2_00924370F028664N/ALGINPESLKTKTMKTQQGILIGGAALRELGNDRYTDDTDYLINDLASKESFINDEENNIDFLNANGNNFFNEIYKIEVGNRIASAQGLFKLKAYAFVQHCQNFNFKKVDSCEYDMKFLVRKFGIKGAKIATKYITSGEYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.