Basic Information | |
---|---|
Taxon OID | 2149837010 Open in IMG/M |
Scaffold ID | LBLPr__contig00728 Open in IMG/M |
Source Dataset Name | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1090 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | LaBonte Lake, Laramie, Wyoming | |||||||
Coordinates | Lat. (o) | 41.321 | Long. (o) | -105.586 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052964 | Metagenome / Metatranscriptome | 142 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LBLPr_02569750 | F052964 | GAG | MDNDSITQRLQNWAWYVTWGVVGPQLDTTCRSFEKNYVPELGSLYEPEEPHYEPDHIDGDLIEQTIKGLPLNQRQVLKLRYVSHPYASINQLAHAARTTVHKLEQDLR |
⦗Top⦘ |