Scaffold STU__NODE_9993_len_3458_cov_20_373627

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold STU__NODE_9993_len_3458_cov_20_373627

Scaffold STU__NODE_9993_len_3458_cov_20_373627

Overview

Basic Information
Taxon OID	2149837023 Open in IMG/M
Scaffold ID	STU__NODE_9993_len_3458_cov_20_373627 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from the University of Arizona (HMP) - UAm1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chinese National Human Genome Center, Beijing
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3516
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location Name	Arizona, USA
Coordinates	Lat. (^o)	32.23	Long. (^o)	-110.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075480	Metagenome	119	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0318.00001860	F075480	AGGAG	MNKTKQEKWQRAYGDTPDSFRQRVAASLPKGEESRHVAFPRRAMVLAAALVLVLTTAYAAVVTHTELVWNAGHPIENEADDRLGLLTGKAGTSGDSLTIGGVTFTVQDGIYSPETGQLFASAVISADESVQLVGVESDMEWEVRAVTPVSEKLDPSGISWAEWAEQNGKTLVPVRMEIRGSEQFPNIPMFGDFLTQNPDGTVSVGFQVDLSEEDVSHLKSCEVQLECRVGAFGKDGKATQWQKEILTATITFK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.