NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SwRhRL3b_contig_3305619

Scaffold SwRhRL3b_contig_3305619


Overview

Basic Information
Taxon OID2162886006 Open in IMG/M
Scaffold IDSwRhRL3b_contig_3305619 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1059
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.794771Long. (o)-84.393804Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002175Metagenome / Metatranscriptome587Y

Sequences

Protein IDFamilyRBSSequence
SwRhRL3b_0767.00001770F002175AGGAGMAILTSVPNEGNNVSVYDVPDDVLSQYAVAGDKAASMFPESGKTSGATIPQSSGGNAMKVDNAESLGEVQAYNDICVCRELLCNPAGCWWHYYYCYC
SwRhRL3b_0767.00001780F002175AGGAGMAILTSSPGAENEVKVYDVPDDVLAQYAMTGDKAAAMFPEKGATAGIPNASAEMSPTKVENAESLGEVQAYSRICVCRELLCNPWRCWWHYYYCYC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.