Scaffold JCVI_READ_1150552

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JCVI_READ_1150552

Scaffold JCVI_READ_1150552

Overview

Basic Information
Taxon OID	2166559018 Open in IMG/M
Scaffold ID	JCVI_READ_1150552 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	983
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007774	Metagenome / Metatranscriptome	345	Y

Sequences

Protein ID	Family	RBS	Sequence
Ocean6-_02679320	F007774	GAG	MSKKDKLTPEQEKELIMLAAEIEAEAIKMKIDYENNPSEESGSVVFVNERSSLLEDEDEELGHQALVSSTQILKKELEKQKKNGDKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.