NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold stn_contig03893

Scaffold stn_contig03893


Overview

Basic Information
Taxon OID2166559019 Open in IMG/M
Scaffold IDstn_contig03893 Open in IMG/M
Source Dataset NameStentor MTG 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLeibniz Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)689
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus → Stentor Amethystinus Microbial Communities From Lake Stechlin, Germany

Source Dataset Sampling Location
Location NameLake Stechlin Germany
CoordinatesLat. (o)53.144075Long. (o)13.02274Alt. (m)Depth (m)68
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004051Metagenome / Metatranscriptome455Y

Sequences

Protein IDFamilyRBSSequence
stn_00386340F004051GAGGMTIDNQLYQVGDLFTTLKSKKTGVIKEIHPQPSGSVRVLLEMPTRETRWTSISAKTLLGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.