Scaffold stn_contig20177

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold stn_contig20177

Scaffold stn_contig20177

Overview

Basic Information
Taxon OID	2166559019 Open in IMG/M
Scaffold ID	stn_contig20177 Open in IMG/M
Source Dataset Name	Stentor MTG 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Leibniz Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	655
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus → Stentor Amethystinus Microbial Communities From Lake Stechlin, Germany

Source Dataset Sampling Location
Location Name	Lake Stechlin Germany
Coordinates	Lat. (^o)	53.144075	Long. (^o)	13.02274	Alt. (m)		Depth (m)	68
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023329	Metagenome / Metatranscriptome	210	N

Sequences

Protein ID	Family	RBS	Sequence
stn_00214030	F023329	GGTGG	MVEETQDKDIAQLQAFFKYNIPTDEILSGRLKVLMADLSWQMDMPTWTKEELDIMCARMDALVEVSNLLYDIQWHRLNWEKKTNG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.