Scaffold G14TP7Y01EN6I3

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold G14TP7Y01EN6I3

Scaffold G14TP7Y01EN6I3

Overview

Basic Information
Taxon OID	2170459019 Open in IMG/M
Scaffold ID	G14TP7Y01EN6I3 Open in IMG/M
Source Dataset Name	Litter degradation MG4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	648
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location Name	University of Illinois Energy Farm
Coordinates	Lat. (^o)	40.1097	Long. (^o)	-88.2041	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045595	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
4MG_03997620	F045595	AGG	TRRSGAVHTVNYAGVPAPTTVGASSGQRAREPDHGGSVTAANAGGSFDGAIRANISPDSQGFANSIDNAFRGRSDNGPVTFSGNESGNKAYAGYLRGGTGNSGTQAGLVPGEYVFYIYTGSVGDVYNVKDGTVARNAFIADEKGFLGWFSCGVSTDQGSGPGSAVADYGNRKGLARMGEP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.