Basic Information | |
---|---|
Taxon OID | 2170459020 Open in IMG/M |
Scaffold ID | G1P06HT01DNMPB Open in IMG/M |
Source Dataset Name | Litter degradation NP2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 674 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Illinois Energy Farm | |||||||
Coordinates | Lat. (o) | 40.1097 | Long. (o) | -88.2041 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007928 | Metagenome / Metatranscriptome | 342 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2NP_00679110 | F007928 | GGA | REPVIWLVLALVARIAEIVAFVLLDQDLIKHDQAEVGAEHELSVIYAQLGQHLASPDPNRVKRPDNYVGRVLAAIFSFGIYMFWWYYNQMEEPNKHFAGNWAQEDELVKAVAAFS |
⦗Top⦘ |