Scaffold GZEQPF102IXA3C

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GZEQPF102IXA3C

Scaffold GZEQPF102IXA3C

Overview

Basic Information
Taxon OID	2170459022 Open in IMG/M
Scaffold ID	GZEQPF102IXA3C Open in IMG/M
Source Dataset Name	Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location Name	United Kingdom: Rothamsted, Harpenden
Coordinates	Lat. (^o)	51.804241	Long. (^o)	-0.372114	Alt. (m)		Depth (m)	0 to .21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000405	Metagenome / Metatranscriptome	1176	Y

Sequences

Protein ID	Family	RBS	Sequence
FA2_07583830	F000405	AGGAGG	MAYYKVRVEVWCDSDPAASDFKEPVEKVFAGDAICTKRQVVDVVDRPQDIEDVAAMSFFGGEEGDADLSQG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.