Scaffold deeps_contig03397.2339

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold deeps_contig03397.2339

Scaffold deeps_contig03397.2339

Overview

Basic Information
Taxon OID	2199352024 Open in IMG/M
Scaffold ID	deeps_contig03397.2339 Open in IMG/M
Source Dataset Name	Bare-fallow DEEP SOIL
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Argonne National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22341
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (61.90%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil

Source Dataset Sampling Location
Location Name	United Kingdom Rothamsted
Coordinates	Lat. (^o)	56.03	Long. (^o)	-2.82	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095770	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
deeps_03953900	F095770	N/A	MRSFPLILIAFGSASFLSAQSWSAWRPDAVYGGIQTRERCAGFNEFANRFVWDVQLRNTYQKNVDVAWAAEPGMLRGAEAQADHALAVKPGEVIDAHHTAPNSCDAGLLVTVNEVRNATAGAPTSAKAMTLRPKIEGRWQSKDPEPLRKELVVQLSGHTVTTSFSSPNFNLQISSPLPEGVSGNVSVERVEQK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.